What
  • Arts - Entertainment
  • Automotive
  • Beauty - Spa
  • Education
  • Event Planning Services
  • Financial Services
  • General Services
  • Health - Medical
  • Home Services
  • Hotels - Travel
  • Local Services
  • Manufacturing
  • Nightlife
  • Professional Services
  • Real Estate
  • Restaurant
  • Shopping
Where
contacts Sign In

Evergreen Family HVAC Repair Service

Add Review
Home » Fountain Valley » Evergreen Family HVAC Repair Service

About Evergreen Family HVAC Repair Service 

Note: This is a FREE (bronze) plan listing. URL links and full descriptions are NOT allowed. More info here

Evergreen Family HVAC Repair Service delivers exceptional heating, cooling, and indoor air quality solutions to Fountain Valley and Orange County. Located at 8966 Warner Ave, Fountain Valley, CA 92708, our certified technicians combine decades of experience with transparent, upfront pricing.

We specialize in energy-efficient upgrades, emergency repairs, and preve....

Unlock for FREE !
Unlocked example

Do you have a review here ? See how to embed it on your own website in 5 seconds !

6293842130fb025780ee2972

TopGoogle would love your feedback. Post a review to our profile and become TOP selection and premium member for FREE.
Let us know the reviewers name so we can upgrade your listing.

Do you recommend Evergreen Family HVAC Repair Service ?

YES I do - NO I don't - MAYBE

getuigen geregeld
Chantal Raghoebarsing

Wrote a review

5

Leiden Vloerisolatie

getuigen geregeld

ze hielpen met verklaringen van getuigen verzamelen dat scheelde veel werk. Continue Reading

Interesting 0 LOL 0 Love 0
Vakkundige vloerisolatie geplaatst
Ricardo Raghoebarsing

Wrote a review

5

Leeuwarden Vloerisolatie

Vakkundige vloerisolatie geplaatst

vloer isolatie laten doen vriendelijke vakmense alles netjes geregeld. Continue Reading

Interesting 0 LOL 0 Love 0
Vloer netjes geïsoleerd
Jair Mangroe

Wrote a review

5

Den Bosch Vloerisolatie

Vloer netjes geïsoleerd

Goede ervaring met het aanbrengen van vloerisolatie. Het team hield zich aan de afspraken en rondde Continue Reading

Interesting 0 LOL 0 Love 0

Show your business reviews and ratings on your own website automatically !

Embed your TopGoogle reviews to your own website in seconds !

Show your Reviews on your own website.

You can automatically show your reviews on your business website , social media accounts, or any other place you like.

How to do it? It is so easy as 1, 2, 3

1. Go to your dashboard. 2. Click on the 3 dots and then click on create widget. 3. Paste the code to your page!

Location & Verified Reviews

Write a review

Your Rating
Browse

Price / Quality

Experience

Professionalism

Communication

Trustworthy

Service

Your review recommended to be at least 140 characters long :)




October, 2026

17

Saturday

DAY OFF
Timezone: Europe/Amsterdam Switch to

August 26,2019

  • Tuesday
  • 9:00am - 10:00am
  • evergreenfamilyhvacrepairservice2
Appointment confirmation email will be sent upon approval.

Awesome Job!

We have received your appointment and will send you a confirmation to your provided email upon approval.

building Own or work here? Claim Now! Claim Now!

building Incorrect business info? Update Now! Update Now!

Choose a Plan to Unlock, Claim and Promote Your Business
  • $2

    / Per Listing

  • Duration : 180 days

    Lorem ipsum dolor sit amet, lorem sit.

  • Map Display
  • Contact Display
  • Image Gallery
  • Video
  • Business Tagline
  • Location
  • Website
  • Social Links
  • FAQ
  • Price Range
  • Tags/Keywords
  • Business Hours
  • Resurva
  • Timekit
  • Menu
  • Announcement
  • Deals-Offers-Discounts
  • Hide competitors Ads
  • Events
  • Submitted on Social Media
  • Featured on Sponsors page
  • No Advertisements !
  • No words limits on description
  • Links allowed on description
  • Claimed Listing
  • TOP Selection
  • Priority indexing on Google
  • No Limits on Reviews
  • No Limits on FAQs
  • No image upload restrictions
  • $9

    / Per Listing

  • Duration : Unlimited days

    Lorem ipsum dolor sit amet, lorem sit.

  • Map Display
  • Contact Display
  • Image Gallery
  • Video
  • Business Tagline
  • Location
  • Website
  • Social Links
  • FAQ
  • Price Range
  • Tags/Keywords
  • Business Hours
  • Resurva
  • Timekit
  • Menu
  • Announcement
  • Deals-Offers-Discounts
  • Hide competitors Ads
  • Events
  • Submitted on Social Media
  • Featured on Sponsors page
  • No Advertisements !
  • No words limits on description
  • Links allowed on description
  • Claimed Listing
  • TOP Selection
  • Priority indexing on Google
  • No Limits on Reviews
  • No Limits on FAQs
  • No image upload restrictions

Claim request is processed after verification. Please check your email inbox for the payment link.

Claiming your business Listing

You agree & accept our Terms & Conditions for posting this information?.

Claim request is processed after verification. Please check your email inbox for the payment link.

Claim requires a Paid plan to be purchased.

Claim your business and allow us 24 to 48 hours to process your request. To avoid fake claimers a plan is required to be purchased. Email should be from the business domain. Gmail or other emails will not be approved. A badge will be added to mark it as official and allow you to update it whenever you want.

Why do I need to pay to claim my listing?

A one time small fee is required, in order to process the request so we can identify and distinguish real businesses from the fake ones. The claimer should choose a paid plan first, fill in the form and after the approval, a link will be send to complete the payment.

Claim This Listing

You agree & accept our Terms & Conditions for posting this information?.

todayTime TodayDay Off!
  • Monday09:00 - 17:00
  • Tuesday09:00 - 17:00
  • Wednesday09:00 - 17:00
  • Thursday09:00 - 17:00
  • Friday09:00 - 17:00
Expand

TOP Selection businesses

Nearby businesses & Competitors

Show your reviews to your own website !